Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yhjC (yhjC)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yhjC (yhjC) spans the amino acid sequence from region 1-66.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yhjC

UniProt

O07557

Expression Region

1-66

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLIHVLAALPFIGILLGIPFANKVTPYVFGMPFILAYIVMWALLTSALMAIVYVLDKEN KKEEAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLR2E Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C5]
TA502488BM 100 µL

POLR2E Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C5]

Sign In for Pricing
View Details
Spastin (Sp 6C6), Biotin conjugate, 0.1mg/mL
BNCB3070-100 1x 100 µL

Spastin (Sp 6C6), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Demephion-O
TRC-D793910-10MG 10 mg

Demephion-O

Sign In for Pricing
View Details
PCDHB4 (NM_018938) Human Over-expression Lysate
LC402713 20 µg

PCDHB4 (NM_018938) Human Over-expression Lysate

Sign In for Pricing
View Details
JKIP2 Antibody
8C11472-AAT 50 µg

JKIP2 Antibody

Sign In for Pricing
View Details
HEPN1 Human Gene Knockout Kit (CRISPR)
KN417514 1 Kit

HEPN1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details