Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yhjC (yhjC)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yhjC (yhjC) spans the amino acid sequence from region 1-66.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yhjC

UniProt

O07557

Expression Region

1-66

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLIHVLAALPFIGILLGIPFANKVTPYVFGMPFILAYIVMWALLTSALMAIVYVLDKEN KKEEAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRARP Rabbit Polyclonal Antibody
TA379306 100 µL

NRARP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRIM41 Human qPCR Primer Pair (NM_033549)
HP216464 200 Reactions

TRIM41 Human qPCR Primer Pair (NM_033549)

Sign In for Pricing
View Details
HIG2 (HILPDA) Human Gene Knockout Kit (CRISPR)
KN200185LP 1 Kit

HIG2 (HILPDA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant HCV (serotype 1c, isolate HC-G9) E2 Protein (His Tag)
PKSV030177 100 µg

Recombinant HCV (serotype 1c, isolate HC-G9) E2 Protein (His Tag)

Sign In for Pricing
View Details
Polystyrene AM NH₂
H10002.25G 25 g

Polystyrene AM NH₂

Sign In for Pricing
View Details
Scrg1 Mouse Gene Knockout Kit (CRISPR)
KN515401 1 Kit

Scrg1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details