Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yhjC (yhjC)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yhjC (yhjC) spans the amino acid sequence from region 1-66.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yhjC

UniProt

O07557

Expression Region

1-66

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLIHVLAALPFIGILLGIPFANKVTPYVFGMPFILAYIVMWALLTSALMAIVYVLDKEN KKEEAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HtrA Serine Peptidase 4 (HTRA4) ELISA Kit
RD-HTRA4-Hu-01 96 Tests

Human HtrA Serine Peptidase 4 (HTRA4) ELISA Kit

Sign In for Pricing
View Details
Human HtrA Serine Peptidase 4 (HTRA4) ELISA Kit
RD-HTRA4-Hu-02 48 Tests

Human HtrA Serine Peptidase 4 (HTRA4) ELISA Kit

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
BNC470965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CHURC1-FNTB (N-term) Rabbit Polyclonal Antibody
AP51695PU-N 400 µL

CHURC1-FNTB (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Liver
CR561488 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
DCUN1D3 (NM_173475) Human Recombinant Protein
TP308082M 100 µg

DCUN1D3 (NM_173475) Human Recombinant Protein

Sign In for Pricing
View Details