Recombinant Synechococcus sp. Photosystem II reaction center protein H (psbH)
This Recombinant Synechococcus sp. Photosystem II reaction center protein H (psbH) spans the amino acid sequence from region 1-66.
Product Specifications
Product Name Alternative
Photosystem II reaction center protein H, PSII-H
UniProt
Q3AMZ3
Expression Region
1-66
Origin
Synechococcus sp. (strain CC9605)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAQRTRLGDLLRPLNSEYGKVVPGWGTTPVMGIFMVLFLVFLLVILQLYNKSLILEGINV NWNGLG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470965-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880253-500 1x 500 µL
Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471712-100 1x 100 µL
GP2 (Glycoprotein 2) / ZAP75 (GP2/1712), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details