Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Equine arteritis virus Envelope small membrane protein (GP2a)

This Recombinant Equine arteritis virus Envelope small membrane protein (GP2a) spans the amino acid sequence from region 2-67.

Product Specifications

Product Name Alternative

Envelope small membrane protein, Protein E, Glycoprotein 2a, Protein GP2a

UniProt

Q91DM1

Expression Region

2-67

Origin

Equine arteritis virus (strain Bucyrus) (EAV)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GLVWSLISNSIQTIIADFAISVIDAALFFLMLLALAVVTVFLFWLIVAIGRSLVARCSRG ARYRPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Phenylthio-5-propionylphenylacetic Acid
TRC-P337050-25G 25 g

2-Phenylthio-5-propionylphenylacetic Acid

Sign In for Pricing
View Details
AATOM™ 680 alkyne
70294-AAT 1 mg

AATOM™ 680 alkyne

Sign In for Pricing
View Details
MINA53 (MINA) (NM_001042533) Human Over-expression Lysate
LC425769 20 µg

MINA53 (MINA) (NM_001042533) Human Over-expression Lysate

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/3416), CF647 conjugate, 0.1mg/mL
BNC473416-100 1x 100 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/3416), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CBX8 (Center) Rabbit Polyclonal Antibody
AP50746PU-N 400 µL

CBX8 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Strept. Avidin Peroxidase Colloidal Gold, 1mL 10nm
HGA-02-10 1 mL

Strept. Avidin Peroxidase Colloidal Gold, 1mL 10nm

Sign In for Pricing
View Details