Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Equine arteritis virus Envelope small membrane protein (GP2a)

This Recombinant Equine arteritis virus Envelope small membrane protein (GP2a) spans the amino acid sequence from region 2-67.

Product Specifications

Product Name Alternative

Envelope small membrane protein, Protein E, Glycoprotein 2a, Protein GP2a

UniProt

Q91DM1

Expression Region

2-67

Origin

Equine arteritis virus (strain Bucyrus) (EAV)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GLVWSLISNSIQTIIADFAISVIDAALFFLMLLALAVVTVFLFWLIVAIGRSLVARCSRG ARYRPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BEX1 Human Gene Knockout Kit (CRISPR)
KN420965 1 Kit

BEX1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ATP2B2 (NM_001001331) Human Recombinant Protein
TP321710 20 µg

ATP2B2 (NM_001001331) Human Recombinant Protein

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/1799R), CF405S conjugate, 0.1mg/mL
BNC041799-500 1x 500 µL

P53 Tumor Suppressor Protein (TP53/1799R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Buparvaquone
TRC-B689555-5MG 5 mg

Buparvaquone

Sign In for Pricing
View Details
CD5 (C5/473), CF488A conjugate, 0.1mg/mL
BNC880473-500 1x 500 µL

CD5 (C5/473), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/2947R), CF640R conjugate, 0.1mg/mL
BNC402947-500 1x 500 µL

IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/2947R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details