Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Equine arteritis virus Envelope small membrane protein (GP2a)

This Recombinant Equine arteritis virus Envelope small membrane protein (GP2a) spans the amino acid sequence from region 2-67.

Product Specifications

Product Name Alternative

Envelope small membrane protein, Protein E, Glycoprotein 2a, Protein GP2a

UniProt

Q91DM1

Expression Region

2-67

Origin

Equine arteritis virus (strain Bucyrus) (EAV)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GLVWSLISNSIQTIIADFAISVIDAALFFLMLLALAVVTVFLFWLIVAIGRSLVARCSRG ARYRPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Benzylidenecamphor
TRC-B280048-50MG 50 mg

3-Benzylidenecamphor

Sign In for Pricing
View Details
Human CD80 Recombinant Rabbit monoclonal Antibody
HA723123 100 µL

Human CD80 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
ZNF516 Human Gene Knockout Kit (CRISPR)
KN421220 1 Kit

ZNF516 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FUB-AMB
TRC-F805040-10MG 10 mg

FUB-AMB

Sign In for Pricing
View Details
PDE5A Rabbit Polyclonal Antibody
TA371462 100 µL

PDE5A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BASP1 (Center) Rabbit Polyclonal Antibody
AP50343PU-N 400 µL

BASP1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details