Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Protein AaeX (aaeX)

This Recombinant Escherichia coli Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

P46478

Expression Region

1-67

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IgD26), CF740 conjugate, 0.1mg/mL
BNC742097-100 1x 100 µL

Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IgD26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD41a (ITGA2B/1036), CF740 conjugate, 0.1mg/mL
BNC741036-500 1x 500 µL

CD41a (ITGA2B/1036), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung: right upper lobe
CB540731 1 Block

Frozen Tissue Blocks, Lung: right upper lobe

Sign In for Pricing
View Details
3,4-Dichlorophenoxyacetic acid
TRC-D474155-5G 5 g

3,4-Dichlorophenoxyacetic acid

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS710432 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
KAT3B / p300 Recombinant Rabbit monoclonal Antibody
HA751552 100 µL

KAT3B / p300 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details