Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Protein AaeX (aaeX)

This Recombinant Escherichia coli Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

P46478

Expression Region

1-67

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIM 3 (HAVCR2) Mouse Monoclonal Antibody [Clone ID: OTI7B10]
CF812575 100 µg

TIM 3 (HAVCR2) Mouse Monoclonal Antibody [Clone ID: OTI7B10]

Sign In for Pricing
View Details
Ubiquitin (UBB) Mouse Monoclonal Antibody [Clone ID: 10C2-2]
AM10231SU-N 1 mL

Ubiquitin (UBB) Mouse Monoclonal Antibody [Clone ID: 10C2-2]

Sign In for Pricing
View Details
Human RNF122 activation kit by CRISPRa
GA112673 1 Kit

Human RNF122 activation kit by CRISPRa

Sign In for Pricing
View Details
Human PEX11C (PEX11G) activation kit by CRISPRa
GA114253 1 Kit

Human PEX11C (PEX11G) activation kit by CRISPRa

Sign In for Pricing
View Details
Digitoxigenin
TRC-D445540-25MG 25 mg

Digitoxigenin

Sign In for Pricing
View Details
(9b,11b,16a)-9,11-Epoxy-16,17,21-trihydroxypregna-1,4-diene-3,20-dione
TRC-E589935-50MG 50 mg

(9b,11b,16a)-9,11-Epoxy-16,17,21-trihydroxypregna-1,4-diene-3,20-dione

Sign In for Pricing
View Details