Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein AaeX (aaeX)

This Recombinant Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

A1AGD5

Expression Region

1-67

Origin

Escherichia coli O1:K1 / APEC

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLLPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OSR8 Antibody
orb840309 2 mg

OSR8 Antibody

Sign In for Pricing
View Details
MANBAL Protein Vector (Human) (pPM-C-HA)
PV024939 500 ng

MANBAL Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-SPINT1 Antibody
A04685 100 µL

Anti-SPINT1 Antibody

Sign In for Pricing
View Details
RBBP8 Rabbit Polyclonal Antibody
orb630553-01 50 µg

RBBP8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RBBP8 Rabbit Polyclonal Antibody
orb630553-02 100 µg

RBBP8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Zfp703 ORF Vector (Rat) (pORF)
ORF079520 1.0 µg DNA

Zfp703 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details