Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pestis Protein AaeX (aaeX)

This Recombinant Yersinia pestis Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

A4THE8

Expression Region

1-67

Origin

Yersinia pestis (strain Pestoides F)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLPVMVIFGLSFPPIFLELLISLALFFVVRRILQPTGIYEFVWHPALFNTALYCCLFY LTSRLFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBBP5 Rabbit Polyclonal Antibody
HA500389 100 µL

RBBP5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GnRH-Receptor (LHRH Receptor) (F1G4), 1mg/mL
BNUM0767-50 1x 50 µL

GnRH-Receptor (LHRH Receptor) (F1G4), 1mg/mL

Sign In for Pricing
View Details
(±)-Cryptone
TRC-C827465-500MG 500 mg

(±)-Cryptone

Sign In for Pricing
View Details
MRPP3 (KIAA0391) Rabbit Polyclonal Antibody
TA361721 100 µL

MRPP3 (KIAA0391) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ADAM10 Rabbit Polyclonal Antibody
ER1706-97 100 µL

ADAM10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CAMK2B Mouse Monoclonal Antibody [Clone ID: OTI8D9]
CF808345 100 µg

CAMK2B Mouse Monoclonal Antibody [Clone ID: OTI8D9]

Sign In for Pricing
View Details