Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pestis Protein AaeX (aaeX)

This Recombinant Yersinia pestis Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

A4THE8

Expression Region

1-67

Origin

Yersinia pestis (strain Pestoides F)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLPVMVIFGLSFPPIFLELLISLALFFVVRRILQPTGIYEFVWHPALFNTALYCCLFY LTSRLFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS505056 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
PFKM Recombinant Rabbit Monoclonal Antibody [JU53-31]
ET7106-97 100 µL

PFKM Recombinant Rabbit Monoclonal Antibody [JU53-31]

Sign In for Pricing
View Details
Human IRX6 activation kit by CRISPRa
GA112413 1 Kit

Human IRX6 activation kit by CRISPRa

Sign In for Pricing
View Details
RH 155 Potassium Salt
TRC-R317005-50MG 50 mg

RH 155 Potassium Salt

Sign In for Pricing
View Details
IL36A Mouse
OM296394-01 10 µg

IL36A Mouse

Sign In for Pricing
View Details
IL36A Mouse
OM296394-02 2 µg

IL36A Mouse

Sign In for Pricing
View Details