Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter sp. Protein AaeX (aaeX)

This Recombinant Enterobacter sp. Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

A4WF56

Expression Region

1-67

Origin

Enterobacter sp. (strain 638)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVFVVFGLSFPPIFFELILSLAIFWLVRKLLAPTGIYDFVWHPALFNTALYCCLFY LISRMFV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC283999 shRNA Plasmid (h)
sc-94091-SH 20 µg

LOC283999 shRNA Plasmid (h)

Sign In for Pricing
View Details
Dopey-2 Double Nickase Plasmid (m2)
sc-427600-NIC-2 20 µg

Dopey-2 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
LSMD1 antibody
70R-10080 50 ug

LSMD1 antibody

Sign In for Pricing
View Details
Phospho-GAP43 (Ser41) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-1641R-BF647-TR 20 µL

Phospho-GAP43 (Ser41) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
FCRLB Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV651168 1.0 µg DNA

FCRLB Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
POU6F2, NT (POU6F2, RPF1, POU domain, class 6, transcription factor 2, Retina-derived POU domain factor 1)
040293 200 µL

POU6F2, NT (POU6F2, RPF1, POU domain, class 6, transcription factor 2, Retina-derived POU domain factor 1)

Sign In for Pricing
View Details