Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter sp. Protein AaeX (aaeX)

This Recombinant Enterobacter sp. Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

A4WF56

Expression Region

1-67

Origin

Enterobacter sp. (strain 638)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVFVVFGLSFPPIFFELILSLAIFWLVRKLLAPTGIYDFVWHPALFNTALYCCLFY LISRMFV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF114 Over-expression Lysate Product
GWB-C82D2B 0.1 mg

ZNF114 Over-expression Lysate Product

Sign In for Pricing
View Details
FBXW9 Protein Vector (Rat) (pPM-C-HA)
20372026 500 ng

FBXW9 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Elongator complex protein 3 (ELP3), partial
MBS1377932 Inquire

Recombinant Oryza sativa subsp. japonica Elongator complex protein 3 (ELP3), partial

Sign In for Pricing
View Details
FAAH2 Rabbit pAb
E45R29333N-100 100 µL

FAAH2 Rabbit pAb

Sign In for Pricing
View Details
AGT Polyclonal Antibody
ANT-10127-100ug 100 µg

AGT Polyclonal Antibody

Sign In for Pricing
View Details
Compound Pendulum, Katers, Reversible
1030800 1 Each

Compound Pendulum, Katers, Reversible

Sign In for Pricing
View Details