Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pseudotuberculosis serotype O:1b Protein AaeX (aaeX)

This Recombinant Yersinia pseudotuberculosis serotype O:1b Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

A7FDT4

Expression Region

1-67

Origin

Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLPVMVIFGLSFPPIFLELLISLALFFVVRRILQPTGIYEFVWHPALFNTALYCCLFY LTSRLFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMAN2L (NM_030805) Human Over-expression Lysate
LY410700 100 µg

LMAN2L (NM_030805) Human Over-expression Lysate

Sign In for Pricing
View Details
IFNA6 Protein Vector (Mouse) (pPM-C-HA)
24259024 500 ng

IFNA6 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Antibacterial agent 271
orb3028545-01 10 mg

Antibacterial agent 271

Sign In for Pricing
View Details
Antibacterial agent 271
orb3028545-02 50 mg

Antibacterial agent 271

Sign In for Pricing
View Details
RPS10P5, Human (His-SUMO)
HY-P71640 1 Each

RPS10P5, Human (His-SUMO)

Sign In for Pricing
View Details
DHCR24 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
18167154 3x 1.0 µg DNA

DHCR24 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details