Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pseudotuberculosis serotype O:1b Protein AaeX (aaeX)

This Recombinant Yersinia pseudotuberculosis serotype O:1b Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

A7FDT4

Expression Region

1-67

Origin

Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLPVMVIFGLSFPPIFLELLISLALFFVVRRILQPTGIYEFVWHPALFNTALYCCLFY LTSRLFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMPR2 Antibody
MBS8581667-01 0.1 mL

BMPR2 Antibody

Sign In for Pricing
View Details
BMPR2 Antibody
MBS8581667-02 0.1 mL (AF635)

BMPR2 Antibody

Sign In for Pricing
View Details
BMPR2 Antibody
MBS8581667-03 0.1 mL (AF610)

BMPR2 Antibody

Sign In for Pricing
View Details
BMPR2 Antibody
MBS8581667-04 0.1 mL (AF405S)

BMPR2 Antibody

Sign In for Pricing
View Details
BMPR2 Antibody
MBS8581667-05 0.1 mL (AF405L)

BMPR2 Antibody

Sign In for Pricing
View Details
BMPR2 Antibody
MBS8581667-06 0.1 mL (AF546)

BMPR2 Antibody

Sign In for Pricing
View Details