Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ignicoccus hospitalis Major outer membrane protein 1 (ihomp1)

This Recombinant Ignicoccus hospitalis Major outer membrane protein 1 (ihomp1) spans the amino acid sequence from region 19-85.

Product Specifications

Product Name Alternative

Major outer membrane protein 1, Ihomp1, Outer membrane protein Imp1227

UniProt

A8ABZ0

Expression Region

19-85

Origin

Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GIGYTAVIALAALVLVMGALGLVLKVAAAAGALPSEVAKVANALPGLKASVDANPAAGSL SSVSVST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

METTL15P1 Antibody
KC-3585-01 50 μL

METTL15P1 Antibody

Sign In for Pricing
View Details
METTL15P1 Antibody
KC-3585-02 100 µL

METTL15P1 Antibody

Sign In for Pricing
View Details
METTL15P1 Antibody
KC-3585-03 1 mL

METTL15P1 Antibody

Sign In for Pricing
View Details
CNTN4 Antibody
8C15240-AAT 50 µg

CNTN4 Antibody

Sign In for Pricing
View Details
CES4A Rabbit Polyclonal Antibody
TA371796 100 µL

CES4A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Pregnanetriol
TRC-P705160-25MG 25 mg

Pregnanetriol

Sign In for Pricing
View Details