Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ignicoccus hospitalis Major outer membrane protein 1 (ihomp1)

This Recombinant Ignicoccus hospitalis Major outer membrane protein 1 (ihomp1) spans the amino acid sequence from region 19-85.

Product Specifications

Product Name Alternative

Major outer membrane protein 1, Ihomp1, Outer membrane protein Imp1227

UniProt

A8ABZ0

Expression Region

19-85

Origin

Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GIGYTAVIALAALVLVMGALGLVLKVAAAAGALPSEVAKVANALPGLKASVDANPAAGSL SSVSVST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Heptyl chloroformate
TRC-H295730-250MG 250 mg

Heptyl chloroformate

Sign In for Pricing
View Details
Dibutyl 3-Hydroxybutyl Phosphate
TRC-D428155-5MG 5 mg

Dibutyl 3-Hydroxybutyl Phosphate

Sign In for Pricing
View Details
AIF1 / Iba1 (Microglia Marker) (rAIF1/1909), CF568 conjugate, 0.1mg/mL
BNC682346-100 1x 100 µL

AIF1 / Iba1 (Microglia Marker) (rAIF1/1909), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human OR10H2 activation kit by CRISPRa
GA108900 1 Kit

Human OR10H2 activation kit by CRISPRa

Sign In for Pricing
View Details
3-Aminobiphenyl
TRC-A601808-1G 1 g

3-Aminobiphenyl

Sign In for Pricing
View Details
VC pBR 322/ Hae III Marker, 50µg
NM2429 50 µg

VC pBR 322/ Hae III Marker, 50µg

Sign In for Pricing
View Details