Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Citrobacter koseri Protein AaeX (aaeX)

This Recombinant Citrobacter koseri Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

A8AQD6

Expression Region

1-67

Origin

Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRMLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENPP4 Rabbit pAb
orb2718105-01 50 µL

ENPP4 Rabbit pAb

Sign In for Pricing
View Details
ENPP4 Rabbit pAb
orb2718105-02 100 µL

ENPP4 Rabbit pAb

Sign In for Pricing
View Details
Eph receptor A2 (EPHA2) Rabbit Polyclonal Antibody
TA350659 100 µL

Eph receptor A2 (EPHA2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TOMM40 Polyclonal Antibody, RBITC Conjugated
bs-17227R-RBITC 100 µL

TOMM40 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
ARHGEF15 CRISPR/Cas9 KO Plasmid (m)
sc-436735 20 µg

ARHGEF15 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Human Vascular Endothelial cell Growth Factor (VEGF) ELISA Kit
QY-E00711 96 Tests

Human Vascular Endothelial cell Growth Factor (VEGF) ELISA Kit

Sign In for Pricing
View Details