Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella arizonae Protein AaeX (aaeX)

This Recombinant Salmonella arizonae Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

A9MNW8

Expression Region

1-67

Origin

Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bis(2-ethoxyethyl) Phthalate (>90%)
TRC-B399785-5MG 5 mg

Bis(2-ethoxyethyl) Phthalate (>90%)

Sign In for Pricing
View Details
COL1A1 Recombinant Rabbit monoclonal Antibody
HA750188 100 µL

COL1A1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
L-Ascorbic Acid-13C6
TRC-A786992-2.5MG 2.5 mg

L-Ascorbic Acid-13C6

Sign In for Pricing
View Details
ASCL1 Rabbit Polyclonal Antibody
AP20781PU-N 100 µg

ASCL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mini Sample Mouse IL-22 (Interleukin 22) ELISA Kit
E-MSEL-M0040-01 24 Tests

Mini Sample Mouse IL-22 (Interleukin 22) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse IL-22 (Interleukin 22) ELISA Kit
E-MSEL-M0040-02 48 Tests

Mini Sample Mouse IL-22 (Interleukin 22) ELISA Kit

Sign In for Pricing
View Details