Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc punctiforme Photosystem II reaction center protein H (psbH)

This Recombinant Nostoc punctiforme Photosystem II reaction center protein H (psbH) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Photosystem II reaction center protein H, PSII-H

UniProt

B2JA13

Expression Region

1-67

Origin

Nostoc punctiforme (strain ATCC 29133 / PCC 73102)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQRTRLGDILKPLNSEYGKVAPGWGTTPVMAVFMALFFVFLLIILQLYNRSLLVQDVLV DWRSLGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF640R conjugate, 0.1mg/mL
BNC400861-100 1x 100 µL

HSP27 (G3.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL
BNC740525-500 1x 500 µL

CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF568 conjugate, 0.1mg/mL
BNC680152-500 1x 500 µL

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL
BNC740630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXA1 / HNF3A (FOXA1/2230R), CF740 conjugate, 0.1mg/mL
BNC742230-100 1x 100 µL

FOXA1 / HNF3A (FOXA1/2230R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (EGP40/1555R), CF647 conjugate, 0.1mg/mL
BNC471555-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (EGP40/1555R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details