Recombinant Yersinia pseudotuberculosis serotype IB Protein AaeX (aaeX)
This Recombinant Yersinia pseudotuberculosis serotype IB Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.
Product Specifications
Product Name Alternative
Protein AaeX
UniProt
B2K438
Expression Region
1-67
Origin
Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSLLPVMVIFGLSFPPIFLELLISLALFFVVRRILQPTGIYEFVWHPALFNTALYCCLFY LTSRLFS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
FB169259-01 5000 mg
2- (4- ((3,5-bis (Trifluoromethyl) phenyl) amino) -3,5-thiazolyl) acetic acid
Sign In for Pricing
View Details FB169259-02 10000 mg
2- (4- ((3,5-bis (Trifluoromethyl) phenyl) amino) -3,5-thiazolyl) acetic acid
Sign In for Pricing
View Details 