Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pseudotuberculosis serotype IB Protein AaeX (aaeX)

This Recombinant Yersinia pseudotuberculosis serotype IB Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

B2K438

Expression Region

1-67

Origin

Yersinia pseudotuberculosis serotype IB (strain PB1/+)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLPVMVIFGLSFPPIFLELLISLALFFVVRRILQPTGIYEFVWHPALFNTALYCCLFY LTSRLFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBE1 Peptide - N-terminal region (AAP64504)
AAP64504-100UG 100 µg

GBE1 Peptide - N-terminal region (AAP64504)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Ghrelin (GHRL)
MBS2118496-01 0.1 mL

PE-Linked Polyclonal Antibody to Ghrelin (GHRL)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Ghrelin (GHRL)
MBS2118496-02 0.2 mL

PE-Linked Polyclonal Antibody to Ghrelin (GHRL)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Ghrelin (GHRL)
MBS2118496-03 0.5 mL

PE-Linked Polyclonal Antibody to Ghrelin (GHRL)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Ghrelin (GHRL)
MBS2118496-04 1 mL

PE-Linked Polyclonal Antibody to Ghrelin (GHRL)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Ghrelin (GHRL)
MBS2118496-05 5 mL

PE-Linked Polyclonal Antibody to Ghrelin (GHRL)

Sign In for Pricing
View Details