Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pseudotuberculosis serotype IB Protein AaeX (aaeX)

This Recombinant Yersinia pseudotuberculosis serotype IB Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

B2K438

Expression Region

1-67

Origin

Yersinia pseudotuberculosis serotype IB (strain PB1/+)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLPVMVIFGLSFPPIFLELLISLALFFVVRRILQPTGIYEFVWHPALFNTALYCCLFY LTSRLFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gamma-Glutamyltransferase 1 (gGT1) ELISA Kit
EK14229 48 Tests

Mouse Gamma-Glutamyltransferase 1 (gGT1) ELISA Kit

Sign In for Pricing
View Details
DBT
MBS5756210 Inquire

DBT

Sign In for Pricing
View Details
PRDM1 Antibody
E51A11320 100 µL

PRDM1 Antibody

Sign In for Pricing
View Details
Scyllo-Inositol
C17708-25mg 25 mg

Scyllo-Inositol

Sign In for Pricing
View Details
hsa-miR-6802-3p Primers
MPH03634 150 µL / 10 µM

hsa-miR-6802-3p Primers

Sign In for Pricing
View Details
Mouse Alpha-Fetoprotein (aFP) ELISA Kit
RDR-aFP-Mu-48Tests 48 Tests

Mouse Alpha-Fetoprotein (aFP) ELISA Kit

Sign In for Pricing
View Details