Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Erwinia tasmaniensis Protein AaeX (aaeX)

This Recombinant Erwinia tasmaniensis Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

B2VGW0

Expression Region

1-67

Origin

Erwinia tasmaniensis (strain DSM 17950 / Et1/99)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVLPVVVVFGMSFPPIFIEIIVSLMLFWLIRRAITPTGLYDLVWHPALFNTALYCCLFY VVSRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Factor Xa
HY-P3009B 1 Each

Porcine Factor Xa

Sign In for Pricing
View Details
Cat TBC1 Domain Family Member 4 (TBC1D4) ELISA Kit
MBS9942169 Inquire

Cat TBC1 Domain Family Member 4 (TBC1D4) ELISA Kit

Sign In for Pricing
View Details
Hs3st3a1-set siRNA/shRNA/RNAi Lentivector (Rat)
23912096 4x 500 ng

Hs3st3a1-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
NIFK Antibody
orb571393-01 50 µg

NIFK Antibody

Sign In for Pricing
View Details
NIFK Antibody
orb571393-02 100 µg

NIFK Antibody

Sign In for Pricing
View Details
PD 169316 25mg
A11221-25 25 mg

PD 169316 25mg

Sign In for Pricing
View Details