Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Erwinia tasmaniensis Protein AaeX (aaeX)

This Recombinant Erwinia tasmaniensis Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

B2VGW0

Expression Region

1-67

Origin

Erwinia tasmaniensis (strain DSM 17950 / Et1/99)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVLPVVVVFGMSFPPIFIEIIVSLMLFWLIRRAITPTGLYDLVWHPALFNTALYCCLFY VVSRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akr1b3 Protein Vector (Mouse) (pPM-C-HA)
11682024 500 ng

Akr1b3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Nori® Canine IgE ELISA Kit- 2 Plates
GR115050-2 2x 96 Well

Nori® Canine IgE ELISA Kit- 2 Plates

Sign In for Pricing
View Details
PTP epsilon Antibody
orb1324873 100 µL

PTP epsilon Antibody

Sign In for Pricing
View Details
PLBD2 Protein Vector (Mouse) (pPM-C-HA)
36937024 500 ng

PLBD2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Polyclonal SPANXN4 Antibody [FITC]
NBP2-98021F 0.1 mL

Rabbit Polyclonal SPANXN4 Antibody [FITC]

Sign In for Pricing
View Details
Klkb1
566663-01 50 µg

Klkb1

Sign In for Pricing
View Details