Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Protein AaeX (aaeX)

This Recombinant Escherichia coli Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

B1XHL4

Expression Region

1-67

Origin

Escherichia coli (strain K12 / DH10B)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Racgap1 (BC010715) Mouse Tagged ORF Clone Lentiviral Particle
MR209580L4V 200 µL

Racgap1 (BC010715) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
UQCRB (NM_001254752) Human Untagged Clone
SC330328 10 µg

UQCRB (NM_001254752) Human Untagged Clone

Sign In for Pricing
View Details
FBXW2 Human Over-expression Lysate
orb1347510 100 µg

FBXW2 Human Over-expression Lysate

Sign In for Pricing
View Details
C11orf54 (NM_014039) Human Over-expression Lysate
LS028970 100 µg

C11orf54 (NM_014039) Human Over-expression Lysate

Sign In for Pricing
View Details
SNX13 CRISPRa sgRNA lentivector (set of three targets)(Rat)
45023126 3x 1.0µg DNA

SNX13 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Recombinant Mouse SUN domain-containing protein 5 (Sun5)
MBS7030640-01 0.02 mg

Recombinant Mouse SUN domain-containing protein 5 (Sun5)

Sign In for Pricing
View Details