Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Protein AaeX (aaeX)

This Recombinant Escherichia coli Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

B1XHL4

Expression Region

1-67

Origin

Escherichia coli (strain K12 / DH10B)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ca5a (NM_019293) Rat Tagged Lenti ORF Clone
RR204765L3 10 µg

Ca5a (NM_019293) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Olr1693 3'UTR GFP Stable Cell Line
TU264941 1.0 mL

Olr1693 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rat Monoclonal Galectin-9 Antibody (766428) [Alexa Fluor 405]
FAB3535V 0.1 mL

Rat Monoclonal Galectin-9 Antibody (766428) [Alexa Fluor 405]

Sign In for Pricing
View Details
Recombinant Human COL5A1, His-tagged
COL5A1-11437H 25 µg

Recombinant Human COL5A1, His-tagged

Sign In for Pricing
View Details
APOL4 Antibody
E11-14542C 100 µg

APOL4 Antibody

Sign In for Pricing
View Details
AdmiRa-mmu-miR-135a-2-3p Virus
mm1146 250 µL

AdmiRa-mmu-miR-135a-2-3p Virus

Sign In for Pricing
View Details