Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella dublin Protein AaeX (aaeX)

This Recombinant Salmonella dublin Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

B5FIU4

Expression Region

1-67

Origin

Salmonella dublin (strain CT_02021853)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRMLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM14A-set siRNA/shRNA/RNAi Lentivector (Human)
46907091 4x 500 ng

TMEM14A-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
UCP2 Antibody, HRP conjugated
A37993-50UG 50 µg

UCP2 Antibody, HRP conjugated

Sign In for Pricing
View Details
Anti-ACTN2 Antibody Picoband®, PE Conjugate
A03673-1-PE 100 µg/Vial

Anti-ACTN2 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
PLX7904
MBS133310 Inquire

PLX7904

Sign In for Pricing
View Details
BRD6989
C07309-5mg 5 mg

BRD6989

Sign In for Pricing
View Details
CYCSP45 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV759697 1.0 µg DNA

CYCSP45 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details