Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Protein AaeX (aaeX)

This Recombinant Salmonella paratyphi A Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

B5BGS0

Expression Region

1-67

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRMLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MNK1 (MKNK1) (N-term) Rabbit Polyclonal Antibody
AP13792PU-N 400 µL

MNK1 (MKNK1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Myelin Basic Protein (MBP) Rabbit Monoclonal Antibody
TA422879 100 µL

Myelin Basic Protein (MBP) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MST4 (STK26) (NM_001042453) Human Over-expression Lysate
LY420913 100 µg

MST4 (STK26) (NM_001042453) Human Over-expression Lysate

Sign In for Pricing
View Details
4,6-Dichloro-5-nitropyrimidine
TRC-D435645-50G 50 g

4,6-Dichloro-5-nitropyrimidine

Sign In for Pricing
View Details
Test Tubes
T1121 5000 Units/Case

Test Tubes

Sign In for Pricing
View Details
NHEDC1 (SLC9B1) (NM_001100874) Human Over-expression Lysate
LY420298 100 µg

NHEDC1 (SLC9B1) (NM_001100874) Human Over-expression Lysate

Sign In for Pricing
View Details