Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Protein AaeX (aaeX)

This Recombinant Salmonella paratyphi A Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

B5BGS0

Expression Region

1-67

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRMLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RIBC2 activation kit by CRISPRa
GA108775 1 Kit

Human RIBC2 activation kit by CRISPRa

Sign In for Pricing
View Details
Dystrophia myotonica protein kinase (DMPK) Human Gene Knockout Kit (CRISPR)
KN209151RB 1 Kit

Dystrophia myotonica protein kinase (DMPK) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
6-Thioxanthine
TRC-T385800-250MG 250 mg

6-Thioxanthine

Sign In for Pricing
View Details
EIF4EBP3 Mouse Monoclonal Antibody [Clone ID: OTI2E7]
CF811912 100 µg

EIF4EBP3 Mouse Monoclonal Antibody [Clone ID: OTI2E7]

Sign In for Pricing
View Details
Mouse CX3CL1 (Chemokine C-X3-C-Motif Ligand 1) ELISA Kit
E-EL-M0267-01 24 Tests

Mouse CX3CL1 (Chemokine C-X3-C-Motif Ligand 1) ELISA Kit

Sign In for Pricing
View Details
Mouse CX3CL1 (Chemokine C-X3-C-Motif Ligand 1) ELISA Kit
E-EL-M0267-02 48 Tests

Mouse CX3CL1 (Chemokine C-X3-C-Motif Ligand 1) ELISA Kit

Sign In for Pricing
View Details