Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Protein AaeX (aaeX)

This Recombinant Salmonella paratyphi A Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

B5BGS0

Expression Region

1-67

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRMLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAL Antibody
KC-3658-01 50 μL

GAL Antibody

Sign In for Pricing
View Details
GAL Antibody
KC-3658-02 100 µL

GAL Antibody

Sign In for Pricing
View Details
GAL Antibody
KC-3658-03 1 mL

GAL Antibody

Sign In for Pricing
View Details
SCOC (NM_001153446) Human Over-expression Lysate
LY431758 100 µg

SCOC (NM_001153446) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti Human HMGB1 Polyclonal
Y054927 100 µL

Anti Human HMGB1 Polyclonal

Sign In for Pricing
View Details
PLTP Rabbit Monoclonal Antibody
TA423724 100 µL

PLTP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details