Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C Protein AaeX (aaeX)

This Recombinant Salmonella paratyphi C Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

C0PZR1

Expression Region

1-67

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRMLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAL (NM_001159280) Human Over-expression Lysate
LC431285 20 µg

ADAL (NM_001159280) Human Over-expression Lysate

Sign In for Pricing
View Details
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1921), CF640R conjugate, 0.1mg/mL
BNC401921-500 1x 500 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1921), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Trimorphamid
TRC-T798385-500MG 500 mg

Trimorphamid

Sign In for Pricing
View Details
PRAK (MAPKAPK5) Mouse Monoclonal Antibody [Clone ID: OTI1D11]
CF804231 100 µg

PRAK (MAPKAPK5) Mouse Monoclonal Antibody [Clone ID: OTI1D11]

Sign In for Pricing
View Details
Lepr (LepRb / OBRb) Chicken Polyclonal Antibody
CH14104-100 100 µL

Lepr (LepRb / OBRb) Chicken Polyclonal Antibody

Sign In for Pricing
View Details
CD40 Ligand / CD154 / TRAP1 (Activation Marker of T-Lymphocytes) (CD40LG/2761), Biotin conjugate, 0.1mg/mL
BNCB2761-100 1x 100 µL

CD40 Ligand / CD154 / TRAP1 (Activation Marker of T-Lymphocytes) (CD40LG/2761), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details