Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C Protein AaeX (aaeX)

This Recombinant Salmonella paratyphi C Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

C0PZR1

Expression Region

1-67

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRMLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C9orf6 (FAM206A) activation kit by CRISPRa
GA110391 1 Kit

Human C9orf6 (FAM206A) activation kit by CRISPRa

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1747R), CF568 conjugate, 0.1mg/mL
BNC681747-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1747R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Human Kappa (Free & Bound)
HAF-007-1 1 mL

Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Human Kappa (Free & Bound)

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS805919 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Z-DEVD-ProRed™ 620
13433-AAT 1 mg

Z-DEVD-ProRed™ 620

Sign In for Pricing
View Details
1,3-Diphenylacetone
TRC-D493443-500MG 500 mg

1,3-Diphenylacetone

Sign In for Pricing
View Details