Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C Protein AaeX (aaeX)

This Recombinant Salmonella paratyphi C Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

C0PZR1

Expression Region

1-67

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRMLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Monoclonal Antibody to Free+Bound Kappa Light Chain,  20nm
GM-101-20 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Free+Bound Kappa Light Chain, 20nm

Sign In for Pricing
View Details
MAGEB2 (N-term) Rabbit Polyclonal Antibody
AP13137PU-N 400 µL

MAGEB2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Adenosine Monophosphate Deaminase 3 (AMPD3) (AMPD3/901), CF488A conjugate, 0.1mg/mL
BNC880901-500 1x 500 µL

Adenosine Monophosphate Deaminase 3 (AMPD3) (AMPD3/901), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IL-7 Antibody Pair Set
E-KAB-0479 50 µL & 100 µg

Human IL-7 Antibody Pair Set

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF740 conjugate, 0.1mg/mL
BNC742040-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Collagen alpha-1 (I) chain/COL1A1 protein (TRX, His tag)
PDEH100790-01 20 µg

Recombinant Human Collagen alpha-1 (I) chain/COL1A1 protein (TRX, His tag)

Sign In for Pricing
View Details