Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Protein AaeX (aaeX)

This Recombinant Escherichia coli Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

C4ZSY0

Expression Region

1-67

Origin

Escherichia coli (strain K12 / MC4100 / BW2952)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phenylbutazone-13C12
TRC-P319571-1MG 1 mg

Phenylbutazone-13C12

Sign In for Pricing
View Details
Ɑ-Hydroxy-ω-Azido PEG
1320000-00-5.1G 1 g

Ɑ-Hydroxy-ω-Azido PEG

Sign In for Pricing
View Details
PAI1 (SERPINE1) Rabbit Monoclonal Antibody [Clone ID: R07-2C3]
TA385228 100 µL

PAI1 (SERPINE1) Rabbit Monoclonal Antibody [Clone ID: R07-2C3]

Sign In for Pricing
View Details
Beta-2-Microglobulin (B2M) (B2M/1118), 1mg/mL
BNUM1118-50 1x 50 µL

Beta-2-Microglobulin (B2M) (B2M/1118), 1mg/mL

Sign In for Pricing
View Details
MAX (Ab-2) Antibody
8B1096-AAT 50 µg

MAX (Ab-2) Antibody

Sign In for Pricing
View Details
Norflurazon-13C,d3
TRC-N684502-1MG 1 mg

Norflurazon-13C,d3

Sign In for Pricing
View Details