Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Protein AaeX (aaeX)

This Recombinant Escherichia coli Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

C4ZSY0

Expression Region

1-67

Origin

Escherichia coli (strain K12 / MC4100 / BW2952)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thymidylate Synthase (TS106), CF740 conjugate, 0.1mg/mL
BNC740714-100 1x 100 µL

Thymidylate Synthase (TS106), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NQO2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C11]
TA504744BM 100 µL

NQO2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C11]

Sign In for Pricing
View Details
EEF1A2 (NM_001958) Human Over-expression Lysate
LC419596 20 µg

EEF1A2 (NM_001958) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 18 (DA7), CF405S conjugate, 0.1mg/mL
BNC040198-500 1x 500 µL

Cytokeratin 18 (DA7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (LK2H10 + PHE5), CF640R conjugate, 0.1mg/mL
BNC400698-100 1x 100 µL

Chromogranin A (LK2H10 + PHE5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
p-Aminophenyl Arsenoxide
TRC-A622500-10MG 10 mg

p-Aminophenyl Arsenoxide

Sign In for Pricing
View Details