Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Protein AaeX (aaeX)

This Recombinant Escherichia coli Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

C4ZSY0

Expression Region

1-67

Origin

Escherichia coli (strain K12 / MC4100 / BW2952)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cell Meter™ Fluorimetric Phagocytosis Assay Kit *Red Fluorescence*
21225-AAT 100 Tests

Cell Meter™ Fluorimetric Phagocytosis Assay Kit *Red Fluorescence*

Sign In for Pricing
View Details
HLA-DRB (MHC II) (DA2), CF568 conjugate, 0.1mg/mL
BNC682281-500 1x 500 µL

HLA-DRB (MHC II) (DA2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Maltose Binding Protein / MBP-probe (R29.6), 0.2mg/mL
BNUB2847-100 1x 100 µL

Maltose Binding Protein / MBP-probe (R29.6), 0.2mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), 0.2mg/mL
BNUB0218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), 0.2mg/mL

Sign In for Pricing
View Details
Metolachlor-d11
TRC-M338703-1MG 1 mg

Metolachlor-d11

Sign In for Pricing
View Details
GlycoLinerTM Biotin Cell Surface Glycoprotein Labeling Kit, 100 Labelings
#30143-T 1 Kit

GlycoLinerTM Biotin Cell Surface Glycoprotein Labeling Kit, 100 Labelings

Sign In for Pricing
View Details