Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pantoea vagans Protein AaeX (aaeX)

This Recombinant Pantoea vagans Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

E1SFM6

Expression Region

1-67

Origin

Pantoea vagans (strain C9-1) (Pantoea agglomerans (strain C9-1) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVLPVFVMFGLSFPPVFIELIISLMLFWLVKRVLTPSGIYDLVWHPALFNTALYCCVFY LVSRLLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/3548), CF568 conjugate, 0.1mg/mL
BNC683548-100 1x 100 µL

Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/3548), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rbx1 (NM_019712) Mouse Tagged ORF Clone
MG200390 10 µg

Rbx1 (NM_019712) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SPAG1 Human Gene Knockout Kit (CRISPR)
KN416556 1 Kit

SPAG1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARFGAP1 Antibody
8C14345-AAT 50 µg

ARFGAP1 Antibody

Sign In for Pricing
View Details
KLC2 (NM_001134774) Human Over-expression Lysate
LY427490 100 µg

KLC2 (NM_001134774) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Nucleoside Diphosphate Kinase 7 (NME7) activation kit by CRISPRa
GA109312 1 Kit

Human Nucleoside Diphosphate Kinase 7 (NME7) activation kit by CRISPRa

Sign In for Pricing
View Details