Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pantoea vagans Protein AaeX (aaeX)

This Recombinant Pantoea vagans Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

E1SFM6

Expression Region

1-67

Origin

Pantoea vagans (strain C9-1) (Pantoea agglomerans (strain C9-1) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVLPVFVMFGLSFPPVFIELIISLMLFWLVKRVLTPSGIYDLVWHPALFNTALYCCVFY LVSRLLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEGF9 Antibody
KC-26571-01 50 μL

MEGF9 Antibody

Sign In for Pricing
View Details
MEGF9 Antibody
KC-26571-02 100 µL

MEGF9 Antibody

Sign In for Pricing
View Details
MEGF9 Antibody
KC-26571-03 1 mL

MEGF9 Antibody

Sign In for Pricing
View Details
Glycidyl Linoleate
TRC-G615720-50MG 50 mg

Glycidyl Linoleate

Sign In for Pricing
View Details
Recombinant Ube1L/UBA7 Antibody
RC-16572-01 50 μL

Recombinant Ube1L/UBA7 Antibody

Sign In for Pricing
View Details
Recombinant Ube1L/UBA7 Antibody
RC-16572-02 100 µL

Recombinant Ube1L/UBA7 Antibody

Sign In for Pricing
View Details