Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Protein AaeX (aaeX)

This Recombinant Escherichia coli Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

B1IQN7

Expression Region

1-67

Origin

Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

12-Hydroxystearic Acid
TRC-H953780-250MG 250 mg

12-Hydroxystearic Acid

Sign In for Pricing
View Details
Mouse Adcy9 activation kit by CRISPRa
GA200077 1 Kit

Mouse Adcy9 activation kit by CRISPRa

Sign In for Pricing
View Details
PDE4 (PDE4B) (NM_002600) Human Recombinant Protein
TP311956L 1 mg

PDE4 (PDE4B) (NM_002600) Human Recombinant Protein

Sign In for Pricing
View Details
ERK5 (MAPK7) Human Gene Knockout Kit (CRISPR)
KN200655LP 1 Kit

ERK5 (MAPK7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti-PIWIL1
Y058112 100 µg

Anti-PIWIL1

Sign In for Pricing
View Details
BECN1 Polyclonal Antibody
AN006940L-01 25 µL

BECN1 Polyclonal Antibody

Sign In for Pricing
View Details