Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Protein AaeX (aaeX)

This Recombinant Escherichia coli Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

B1IQN7

Expression Region

1-67

Origin

Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant PAI1 Monoclonal Antibody
E-AB-81481-01 50 µL

Recombinant PAI1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant PAI1 Monoclonal Antibody
E-AB-81481-02 100 µL

Recombinant PAI1 Monoclonal Antibody

Sign In for Pricing
View Details
THOC2 Human Gene Knockout Kit (CRISPR)
KN422235 1 Kit

THOC2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CCL3 Antibody
KC-7253-01 50 μL

CCL3 Antibody

Sign In for Pricing
View Details
CCL3 Antibody
KC-7253-02 100 µL

CCL3 Antibody

Sign In for Pricing
View Details
CCL3 Antibody
KC-7253-03 1 mL

CCL3 Antibody

Sign In for Pricing
View Details