Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pseudotuberculosis serotype O:3 Protein AaeX (aaeX)

This Recombinant Yersinia pseudotuberculosis serotype O:3 Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

B1JKI1

Expression Region

1-67

Origin

Yersinia pseudotuberculosis serotype O:3 (strain YPIII)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLPVMVIFGLSFPPIFLELLISLALFFVVRRILQPTGIYEFVWHPALFNTALYCCLFY LTSRLFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Imazalil-d5 Sulfate
TRC-I268502-25MG 25 mg

Imazalil-d5 Sulfate

Sign In for Pricing
View Details
rac-Citronellal
TRC-C525020-1G 1 g

rac-Citronellal

Sign In for Pricing
View Details
SuLT2A1 (NM_003167) Human Over-expression Lysate
LY418856 100 µg

SuLT2A1 (NM_003167) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS503678 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Mouse H2-Aa activation kit by CRISPRa
GA201802 1 Kit

Mouse H2-Aa activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Soft tissue
CR559354 5 µg

Tissue Total RNA, Soft tissue

Sign In for Pricing
View Details