Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pseudotuberculosis serotype O:3 Protein AaeX (aaeX)

This Recombinant Yersinia pseudotuberculosis serotype O:3 Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

B1JKI1

Expression Region

1-67

Origin

Yersinia pseudotuberculosis serotype O:3 (strain YPIII)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLPVMVIFGLSFPPIFLELLISLALFFVVRRILQPTGIYEFVWHPALFNTALYCCLFY LTSRLFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LHX2 Mouse Monoclonal Antibody [Clone ID: 6G2]
AM06604SU-N 100 µL

LHX2 Mouse Monoclonal Antibody [Clone ID: 6G2]

Sign In for Pricing
View Details
Scramblase 1 Rabbit Polyclonal Antibody
HA500063 100 µL

Scramblase 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RNF5 Rabbit Polyclonal Antibody
TA381000 100 µL

RNF5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NK1.1 Recombinant Rabbit monoclonal Antibody
HA751222 100 µL

NK1.1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
LOC341835 Human qPCR Primer Pair (XM_292231)
HP221475 200 Reactions

LOC341835 Human qPCR Primer Pair (XM_292231)

Sign In for Pricing
View Details
Human C14orf106 (MIS18BP1) activation kit by CRISPRa
GA110700 1 Kit

Human C14orf106 (MIS18BP1) activation kit by CRISPRa

Sign In for Pricing
View Details