Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pseudotuberculosis serotype O:3 Protein AaeX (aaeX)

This Recombinant Yersinia pseudotuberculosis serotype O:3 Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

B1JKI1

Expression Region

1-67

Origin

Yersinia pseudotuberculosis serotype O:3 (strain YPIII)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLPVMVIFGLSFPPIFLELLISLALFFVVRRILQPTGIYEFVWHPALFNTALYCCLFY LTSRLFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS631527 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Plasmid DNA MaxiPrep Kit-4p
46500 4 Preparations

Plasmid DNA MaxiPrep Kit-4p

Sign In for Pricing
View Details
ULK3 Recombinant Rabbit Monoclonal Antibody [PSH01-09]
HA721621 100 µL

ULK3 Recombinant Rabbit Monoclonal Antibody [PSH01-09]

Sign In for Pricing
View Details
1-Palmitoyl-sn-glycero-3-phosphocholine
TRC-P157345-50MG 50 mg

1-Palmitoyl-sn-glycero-3-phosphocholine

Sign In for Pricing
View Details
Anti-Rat IgG2b Antibody (HRP)
KH-077-01 50 μL

Anti-Rat IgG2b Antibody (HRP)

Sign In for Pricing
View Details
Anti-Rat IgG2b Antibody (HRP)
KH-077-02 100 µL

Anti-Rat IgG2b Antibody (HRP)

Sign In for Pricing
View Details