Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri serotype 5b Protein AaeX (aaeX)

This Recombinant Shigella flexneri serotype 5b Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q0T046

Expression Region

1-67

Origin

Shigella flexneri serotype 5b (strain 8401)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human Calponin-1 (ABT405) Mouse Monoclonal Antibody (Ready to Use)
MBS9511502-01 3 mL (RTU)

Anti-Human Calponin-1 (ABT405) Mouse Monoclonal Antibody (Ready to Use)

Sign In for Pricing
View Details
Anti-Human Calponin-1 (ABT405) Mouse Monoclonal Antibody (Ready to Use)
MBS9511502-02 6 mL (RTU)

Anti-Human Calponin-1 (ABT405) Mouse Monoclonal Antibody (Ready to Use)

Sign In for Pricing
View Details
Anti-Human Calponin-1 (ABT405) Mouse Monoclonal Antibody (Ready to Use)
MBS9511502-03 12 mL (RTU)

Anti-Human Calponin-1 (ABT405) Mouse Monoclonal Antibody (Ready to Use)

Sign In for Pricing
View Details
Anti-Human Calponin-1 (ABT405) Mouse Monoclonal Antibody (Ready to Use)
MBS9511502-04 5x 12 mL (RTU)

Anti-Human Calponin-1 (ABT405) Mouse Monoclonal Antibody (Ready to Use)

Sign In for Pricing
View Details
(E) -tert-Butyldimethyl ((4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) but-3-en-2-yl) oxy) silane
OR1051971-01 250 mg

(E) -tert-Butyldimethyl ((4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) but-3-en-2-yl) oxy) silane

Sign In for Pricing
View Details
(E) -tert-Butyldimethyl ((4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) but-3-en-2-yl) oxy) silane
OR1051971-02 1 g

(E) -tert-Butyldimethyl ((4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) but-3-en-2-yl) oxy) silane

Sign In for Pricing
View Details