Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella dysenteriae serotype 1 Protein AaeX (aaeX)

This Recombinant Shigella dysenteriae serotype 1 Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q32B97

Expression Region

1-67

Origin

Shigella dysenteriae serotype 1 (strain Sd197)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIDE1 (C19orf38) Human Gene Knockout Kit (CRISPR)
KN427094 1 Kit

HIDE1 (C19orf38) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PD1, Mouse (RMP1-14), CF488A conjugate, 0.1mg/mL
BNC882002-500 1x 500 µL

PD1, Mouse (RMP1-14), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FGFR2 Human Gene Knockout Kit (CRISPR)
KN417098 1 Kit

FGFR2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARHGEF4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6E5]
TA812765AM 100 µL

ARHGEF4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6E5]

Sign In for Pricing
View Details
Vps4a Mouse Gene Knockout Kit (CRISPR)
KN519262 1 Kit

Vps4a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Esophagus
CR560989 5 µg

Tissue Total RNA, Esophagus

Sign In for Pricing
View Details