Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella dysenteriae serotype 1 Protein AaeX (aaeX)

This Recombinant Shigella dysenteriae serotype 1 Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q32B97

Expression Region

1-67

Origin

Shigella dysenteriae serotype 1 (strain Sd197)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX2 (Embryonic Stem Cell Marker) (rSOX2/1791), CF405S conjugate, 0.1mg/mL
BNC043648-500 1x 500 µL

SOX2 (Embryonic Stem Cell Marker) (rSOX2/1791), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/1902), CF488A conjugate, 0.1mg/mL
BNC881902-100 1x 100 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/1902), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Supv3l1 Mouse Gene Knockout Kit (CRISPR)
KN516995 1 Kit

Supv3l1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MDM2 (MDM2/2414), CF740 conjugate, 0.1mg/mL
BNC742414-500 1x 500 µL

MDM2 (MDM2/2414), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ccdc198 Mouse Gene Knockout Kit (CRISPR)
KN500078 1 Kit

ccdc198 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AMPS Rabbit Polyclonal Antibody
HA500092 100 µL

AMPS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details