Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella dysenteriae serotype 1 Protein AaeX (aaeX)

This Recombinant Shigella dysenteriae serotype 1 Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q32B97

Expression Region

1-67

Origin

Shigella dysenteriae serotype 1 (strain Sd197)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human IgG (Immunoglobulin G) ELISA Kit
E-UNEL-H0079-01 5x 96 Tests

Uncoated Human IgG (Immunoglobulin G) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human IgG (Immunoglobulin G) ELISA Kit
E-UNEL-H0079-02 15x 96 Tests

Uncoated Human IgG (Immunoglobulin G) ELISA Kit

Sign In for Pricing
View Details
Recombinant Rat Cadherin-8/CDH8 Protein (His Tag)
PKSR030268 50 µg

Recombinant Rat Cadherin-8/CDH8 Protein (His Tag)

Sign In for Pricing
View Details
Rat Enkephalin (ENK) ELISA Kit
RDR-ENK-Ra-01 96 Tests

Rat Enkephalin (ENK) ELISA Kit

Sign In for Pricing
View Details
Rat Enkephalin (ENK) ELISA Kit
RDR-ENK-Ra-02 48 Tests

Rat Enkephalin (ENK) ELISA Kit

Sign In for Pricing
View Details
MST1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A10]
TA808500BM 100 µL

MST1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A10]

Sign In for Pricing
View Details