Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella boydii serotype 4 Protein AaeX (aaeX)

This Recombinant Shigella boydii serotype 4 Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q31WA9

Expression Region

1-67

Origin

Shigella boydii serotype 4 (strain Sb227)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse CP (C-Peptide) ELISA Kit
ELK10033-01 48 Tests

Horse CP (C-Peptide) ELISA Kit

Sign In for Pricing
View Details
Horse CP (C-Peptide) ELISA Kit
ELK10033-02 96 Tests

Horse CP (C-Peptide) ELISA Kit

Sign In for Pricing
View Details
Horse CP (C-Peptide) ELISA Kit
ELK10033-03 5x 96 Tests

Horse CP (C-Peptide) ELISA Kit

Sign In for Pricing
View Details
Dystrobrevin beta (DTNB) Human shRNA Plasmid Kit (Locus ID 1838)
TL304896 1 Kit

Dystrobrevin beta (DTNB) Human shRNA Plasmid Kit (Locus ID 1838)

Sign In for Pricing
View Details
BSc2118
MBS5811074 Inquire

BSc2118

Sign In for Pricing
View Details
CXorf22, ID (Uncharacterized Protein CXorf22, CXorf22) (AP)
MBS6471085-01 0.2 mL

CXorf22, ID (Uncharacterized Protein CXorf22, CXorf22) (AP)

Sign In for Pricing
View Details